Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007372-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007372-M05, RRID:AB_607274
- Product name
- UMPS monoclonal antibody (M05), clone 2F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UMPS.
- Antigen sequence
DYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHL
TPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVG
RGIISAADRLEAAEMYRKAAWEAYLSRLG- Isotype
- IgG
- Antibody clone number
- 2F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Predictive and prognostic markers for the outcome of chemotherapy in advanced colorectal cancer, a retrospective analysis of the phase III randomised CAIRO study.
Koopman M, Venderbosch S, van Tinteren H, Ligtenberg MJ, Nagtegaal I, Van Krieken JH, Punt CJ
European journal of cancer (Oxford, England : 1990) 2009 Jul;45(11):1999-2006
European journal of cancer (Oxford, England : 1990) 2009 Jul;45(11):1999-2006
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of UMPS expression in transfected 293T cell line by UMPS monoclonal antibody (M05), clone 2F5.Lane 1: UMPS transfected lysate(52.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UMPS is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to UMPS on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol