Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007372-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007372-M06, RRID:AB_1112213
- Product name
- UMPS monoclonal antibody (M06), clone 2B10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UMPS.
- Antigen sequence
DYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHL
TPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVG
RGIISAADRLEAAEMYRKAAWEAYLSRLG- Isotype
- IgG
- Antibody clone number
- 2B10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Novel mRNA isoforms and mutations of uridine monophosphate synthetase and 5-fluorouracil resistance in colorectal cancer.
Griffith M, Mwenifumbo JC, Cheung PY, Paul JE, Pugh TJ, Tang MJ, Chittaranjan S, Morin RD, Asano JK, Ally AA, Miao L, Lee A, Chan SY, Taylor G, Severson T, Hou YC, Griffith OL, Cheng GS, Novik K, Moore R, Luk M, Owen D, Brown CJ, Morin GB, Gill S, Tai IT, Marra MA
The pharmacogenomics journal 2013 Apr;13(2):148-58
The pharmacogenomics journal 2013 Apr;13(2):148-58
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UMPS monoclonal antibody (M06), clone 2B10. Western Blot analysis of UMPS expression in IMR-32 ( Cat # L008V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UMPS is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to UMPS on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol