Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405969 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Uridine Monophosphate Synthetase (UMPS) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UMPS antibody: synthetic peptide directed towards the C terminal of human UMPS
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQY
NSPQE VIGKRGSDII- Vial size
- 50 µg
Submitted references Effect of varicocelectomy on patients with unobstructive azoospermia and severe oligospermia.
Orotate phosphoribosyltransferase expression level in tumors is a potential determinant of the efficacy of 5-fluorouracil.
Ishikawa T, Kondo Y, Yamaguchi K, Sakamoto Y, Fujisawa M
BJU international 2008 Jan;101(2):216-8
BJU international 2008 Jan;101(2):216-8
Orotate phosphoribosyltransferase expression level in tumors is a potential determinant of the efficacy of 5-fluorouracil.
Sakamoto E, Nagase H, Kobunai T, Oie S, Oka T, Fukushima M, Oka T
Biochemical and biophysical research communications 2007 Nov 9;363(1):216-22
Biochemical and biophysical research communications 2007 Nov 9;363(1):216-22
No comments: Submit comment
No validations: Submit validation data