Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023543-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023543-M01, RRID:AB_509133
- Product name
- RBM9 monoclonal antibody (M01), clone 4G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RBM9.
- Antigen sequence
MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQ
NGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGE
QSSNSPSTQNGSLTTEGGAQTDGQQSQTQS- Isotype
- IgG
- Antibody clone number
- 4G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references FOX-2 dependent splicing of ataxin-2 transcript is affected by ataxin-1 overexpression.
Welzel F, Kaehler C, Isau M, Hallen L, Lehrach H, Krobitsch S
PloS one 2012;7(5):e37985
PloS one 2012;7(5):e37985
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RBM9 monoclonal antibody (M01), clone 4G3 Western Blot analysis of RBM9 expression in NIH/3T3 ( Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RBM9 expression in transfected 293T cell line by RBM9 monoclonal antibody (M01), clone 4G3.Lane 1: RBM9 transfected lysate(40.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RBM9 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RBM9 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RBM9 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol