HPA006240

RBFOX2 antibody from Sigma-Aldrich
FOX-2, HNRBP2, HRNBP2, RBM9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006240
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006240, RRID:AB_1079750
Product name
Anti-RBM9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006240
Antibody type
Polyclonal
Antigen
RNA-binding protein 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQ
DYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSL
Storage
-20C
Provider Type Product Number
- No reagents -