Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405304 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Insulin Induced Gene 1 (INSIG1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-INSIG1 antibody: synthetic peptide directed towards the middle region of human INSIG1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREW
SSVMR CVAVFVGINH- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Insig2 is associated with colon tumorigenesis and inhibits Bax-mediated apoptosis.
Li CG, Gruidl M, Eschrich S, McCarthy S, Wang HG, Alexandrow MG, Yeatman TJ
International journal of cancer. Journal international du cancer 2008 Jul 15;123(2):273-82
International journal of cancer. Journal international du cancer 2008 Jul 15;123(2):273-82
No comments: Submit comment
No validations: Submit validation data