Antibody data

Product number
ABIN501927
Provider
antibodies-online
Product name
anti-Insulin Induced Gene 1 (INSIG1) antibody
Provider product page
antibodies-online - ABIN501927
Antibody type
Polyclonal
Antigen
The immunogen for anti-INSIG1 antibody: synthetic peptide directed towards the middle region of human INSIG1
Reactivity
Human
Host
Rabbit
Antigen sequence
TTWLFHKTRSNYRVFLKSPIVIESSKPPILRARKI
LEENL TVDYDKDYLF
Vial size
50 µg
Provider Type Product Number
- No reagents -