SAB2101165

INSIG1 antibody from MilliporeSigma / Merck KGaA
CL-6, MGC1405
No application information provided.

Antibody data

Product number
SAB2101165
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2101165, RRID:AB_10600550
Product name
Anti-INSIG1 (ab1) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2101165
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_938150.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TWLFHKTRSNYRVFLKSPIVIESSKPPILRARKIL
EENLTVDYDKDYLFS
Storage
-20C
Provider Type Product Number
- No reagents -