H00050848-M01
antibody from Abnova Corporation
Targeting: F11R
CD321, JAM-1, JAM-A, JAM1, JAMA, JCAM, PAM-1
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00050848-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00050848-M01, RRID:AB_425964
- Product name
- F11R monoclonal antibody (M01), clone 2E3-1C8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant F11R.
- Antigen sequence
MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSE
PEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTT
RLVCYNNKITASYEDRVTFLPTGITFKSVTREDTG
TYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIP
SSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPT
NPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEY
SCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLV
TLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIY
SQPSARSEGEFKQTSSFLV- Isotype
- IgG
- Antibody clone number
- 2E3-1C8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Low expression of junctional adhesion molecule A is associated with metastasis and poor survival in pancreatic cancer.
JAM-A expression positively correlates with poor prognosis in breast cancer patients.
Downregulation of junctional adhesion molecule-A is involved in the progression of clear cell renal cell carcinoma.
Fong D, Spizzo G, Mitterer M, Seeber A, Steurer M, Gastl G, Brosch I, Moser P
Annals of surgical oncology 2012 Dec;19(13):4330-6
Annals of surgical oncology 2012 Dec;19(13):4330-6
JAM-A expression positively correlates with poor prognosis in breast cancer patients.
McSherry EA, McGee SF, Jirstrom K, Doyle EM, Brennan DJ, Landberg G, Dervan PA, Hopkins AM, Gallagher WM
International journal of cancer 2009 Sep 15;125(6):1343-51
International journal of cancer 2009 Sep 15;125(6):1343-51
Downregulation of junctional adhesion molecule-A is involved in the progression of clear cell renal cell carcinoma.
Gutwein P, Schramme A, Voss B, Abdel-Bakky MS, Doberstein K, Ludwig A, Altevogt P, Hansmann ML, Moch H, Kristiansen G, Pfeilschifter J
Biochemical and biophysical research communications 2009 Mar 6;380(2):387-91
Biochemical and biophysical research communications 2009 Mar 6;380(2):387-91
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- F11R monoclonal antibody (M01), clone 2E3-1C8 Western Blot analysis of F11R expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of F11R expression in transfected 293T cell line by F11R monoclonal antibody (M01), clone 2E3-1C8.Lane 1: F11R transfected lysate (Predicted MW: 32.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged F11R is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to F11R on formalin-fixed paraffin-embedded human breast cancer tissue. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between PRKCZ and F11R. HeLa cells were stained with anti-PRKCZ rabbit purified polyclonal 1:1200 and anti-F11R mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)