Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA039991 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-STXBP5
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KSRQPSGAGLCDISEGTVVPEDRCKSPTSAKMSRK
LSLPTDLKPDLDVKDNSFSRSRS- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Platelet secretion and hemostasis require syntaxin-binding protein STXBP5.
Ye S, Huang Y, Joshi S, Zhang J, Yang F, Zhang G, Smyth SS, Li Z, Takai Y, Whiteheart SW
The Journal of clinical investigation 2014 Oct;124(10):4517-28
The Journal of clinical investigation 2014 Oct;124(10):4517-28
No comments: Submit comment
No validations: Submit validation data