R32202

antibody from NSJ Bioreagents

Targeting: RBBP4 lin-53, NURF55, RbAp48

Western blot (Supportive data in Antibodypedia)

Immunohistochemistry (Supportive data in Antibodypedia)

Antibody Data

Product number

R32202

Provider

NSJ Bioreagents

Product name

RBBP4 Antibody / RbAp48 / NURF55

Antibody type

Polyclonal

Antigen

Amino acids EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS of human Retinoblastoma binding protein 4 were used as the immunogen for the RBBP4 antibody.

Description

Antigen affinity

Reactivity

Human, Mouse, Rat

Host

Rabbit

Conjugate

Unconjugated

Vial size

100 µg

Concentration

Lyophilized; resuspend with 200 ul for 0.5 mg/ml

Storage

After reconstitution, the RBBP4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Western blot

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

Western blot testing of 1) rat brain, 2) mouse liver, 3) mouse lung, 4) human HeLa, 5) human Jurkat with RBBP4 antibody. Predicted/observed molecular weight: 48~55 kDa.

Immunohistochemistry

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE human intestinal cancer tissue with RBBP4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE mouse liver with RBBP4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of FFPE rat intestine with RBBP4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of frozen human placental tissue with RBBP4 antibody.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of frozen mouse small intestine tissue with RBBP4 antibody.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of frozen mouse liver tissue with RBBP4 antibody.

Supportive validation

Submitted by

NSJ Bioreagents (provider)

Main image

Experimental details

IHC testing of frozen rat small intestine tissue with RBBP4 antibody.