ABIN501547
antibody from antibodies-online
Targeting: DDX58
DKFZp434J1111, FLJ13599, RIG-1, RIG-I, RIG1
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501547 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 58 (DDX58) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DDX58 antibody: synthetic peptide directed towards the middle region of human DDX58
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAK
IFCAR QNCSHDWGIH- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Impaired cytokine response in myeloid dendritic cells in chronic hepatitis C virus infection regardless of enhanced expression of Toll-like receptors and retinoic acid inducible gene-I.
Miyazaki M, Kanto T, Inoue M, Itose I, Miyatake H, Sakakibara M, Yakushijin T, Kakita N, Hiramatsu N, Takehara T, Kasahara A, Hayashi N
Journal of medical virology 2008 Jun;80(6):980-8
Journal of medical virology 2008 Jun;80(6):980-8
No comments: Submit comment
No validations: Submit validation data