HPA013350

PTPN22 antibody from Sigma-Aldrich
Lyp, Lyp1, Lyp2, PTPN8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013350
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013350, RRID:AB_10601570
Product name
Anti-PTPN22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013350
Antibody type
Polyclonal
Antigen
protein tyrosine phosphatase, non-receptor type 22 (lymphoid) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLLNQESAVLATAPRIDDEIPPPLPVRTPESFIVV
EEAGEFSPNVPKSLSSAVKVKIGTSLEWGGTSEPK
KFDDSVILRPSKSVKLRSPKSELHQDRSSPPPPLP
ERTLESFFLADEDCMQ
Storage
-20C
Provider Type Product Number
- No reagents -