H00001981-B01P

EIF4G1 antibody from Abnova Corporation
EIF4F, EIF4G, p220, PARK18

Antibody data

Product number
H00001981-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001981-B01P, RRID:AB_1573397
Product name
EIF4G1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00001981-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human EIF4G1 protein.
Antigen sequence
MDQYFNQMEKIIKEKKTSSRIRFMLQDVLDLRGSN
WVPRRGDQGPKTIDQIHKEAEMEEHREHIKVQQLM
AKGSDKRRGGPPGPPISRGLPLVDDGGWNTVPISK
GSRPIDTSRLTKITKPGSIDSNNQLFAPGGRLSWG
KGSSGGSGAKPSDAASEAARPATSTLNRFSALQQA
VPTESTDNRRVVQRSSLSRERGEKAGDRGDRLERS
ERGGDRGDRLDRARTPATKRSFSKEVEERSRERPS
QPEGLRKAASLTEDRDRGRDAVKREAALPPVSPLK
AALSEEELEKKSKAIIEEYLHLNDMKEAVQCVQEL
ASPSLLFIFVRHGVESTLERSAIAREHMGQLLHQL
LCAGHLSTAQYYQGLYEILELAEDMEIDIPHVWLY
LAELVTPILQEGGVPMGELFREITKPLRPLGKAAS
LLLEILGLLCKSMGPKKVGTLWREAGLSWKEFLPE
GQDIGAFVAEQKVEYTLGEESEAPGQRALPSEELN
RQLEKLLKEGSSNQRVFDWIEANLSEQQIVSNTLV
RALMTAVCYSAIIFETPLRVDVAVLKARAKLLQKY
LCDEQKELQALYALQALVVTLEQPPNLLRMFFDAL
YDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTA
FFKWLREAEEESDHN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -