Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [2]
 - Proximity ligation assay [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00003586-D01P - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00003586-D01P, RRID:AB_1576286
 - Product name
 - IL10 purified MaxPab rabbit polyclonal antibody (D01P)
 - Antibody type
 - Polyclonal
 - Description
 - Rabbit polyclonal antibody raised against a full-length human IL10 protein.
 - Antigen sequence
 MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPG
NLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESL
LEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDI
KAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVE
QVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMK
IRN- Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western Blot analysis of IL10 expression in transfected 293T cell line (H00003586-T01) by IL10 MaxPab polyclonal antibody.Lane 1: IL10 transfected lysate(20.50 KDa).Lane 2: Non-transfected lysate.
 
- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - IL10 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL10 expression in Jurkat.
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Proximity Ligation Analysis of protein-protein interactions between IL10 and A2M. HeLa cells were stained with anti-IL10 rabbit purified polyclonal 1:1200 and anti-A2M mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
 - Validation comment
 - In situ Proximity Ligation Assay (Cell)