Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN2496872 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Toll-Like Receptor 4 (TLR4) (AA 161-192), (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TLR4 antibody: synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to AA 161-192 within the N-terminal region of Human CD284.
- Reactivity
- Human
- Host
- Goat
- Epitope
- AA 161-192,N-Term
- Vial size
- 0.1 mg
- Storage
- Store at +4°C or at -20°C if preferred. Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody
- Handling
- Avoid repeat freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data