Antibody data

Product number
H00006273-M03A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006273-M03A, RRID:AB_1580330
Product name
S100A2 monoclonal antibody (M03A), clone 3H8
Provider product page
Abnova Corporation - H00006273-M03A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant S100A2.
Antigen sequence
MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMK
ELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQV
DFQEYAVFLALITVMCNDFFQGCPDRP
Isotype
IgG
Antibody clone number
3H8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -