101-M32

KDR antibody from ReliaTech GmbH
CD309, FLK1, VEGFR, VEGFR2

Antibody data

Product number
101-M32
Provider
ReliaTech GmbH
Product name
VEGFR-2/KDR
Provider product page
ReliaTech GmbH - 101-M32
Antibody type
Monoclonal
Antigen
recombinant human soluble KDR (D1-7)
Description
antibody purified from hybridoma supernatant
Reactivity
Human
Host
Mouse
Antigen sequence
ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCR
GQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLT
IPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSP
FIASVSDQHGVVYITENKNKTVVIPCLGSISNLNV
SLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISY
AGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLS
PSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPS
SKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTR
SDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGS
GMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGI
PLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPI
SKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGT
TQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAV
SVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEG
KNKTVSTLVIQAANVSALYKCEAVNKVGRGERVIS
FHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFE
NLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNA
TMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKT
KKRHCVVRQLTVLERVAPTITGNLENQTTSIGESI
EVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGN
RNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFII
EGA
Isotype
IgG
Antibody clone number
(#3(4H3))
Vial size
100 µl
Storage
Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
Handling
Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
Provider Type Product Number
- No reagents -