Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504629 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Kinase insert Domain Receptor (A Type III Receptor tyrosine Kinase) (KDR) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KDR antibody: synthetic peptide directed towards the N terminal of human KDR
- Description
- Affinity Purified
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
LNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMK
KFLST LTIDGVTRSD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Specific association of increased vascular endothelial growth factor expression and its receptors with macrophage differentiation of HL-60 leukemia cells.
Ohsaka A, Hirota-Komatsu S, Shibata M, Ezaki J, Shinohara F, Yoshida T
Biochemical and biophysical research communications 2008 Apr 11;368(3):543-9
Biochemical and biophysical research communications 2008 Apr 11;368(3):543-9
No comments: Submit comment
No validations: Submit validation data