Antibody data

Product number
H00057679-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057679-M02, RRID:AB_1203950
Product name
ALS2 monoclonal antibody (M02), clone 4F10
Provider product page
Abnova Corporation - H00057679-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ALS2.
Antigen sequence
PSQDLKPVPERCNQCSQLLITMTDKEDHVIISDSH
CCPLGVTLTESQAENHASTALSPSTETLDRQEEVF
ENTLVANDQSVATELNAVSAQITSSDAMSS
Isotype
IgG
Antibody clone number
4F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -