Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005728-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005728-M02, RRID:AB_894243
- Product name
- PTEN monoclonal antibody (M02), clone 3E7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PTEN.
- Antigen sequence
TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMG
FPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLC
AERHYDTAKFNCRVAQYPFE- Isotype
- IgG
- Antibody clone number
- 3E7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PTEN monoclonal antibody (M02), clone 3E7 Western Blot analysis of PTEN expression in C32 ( Cat # L002V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PTEN on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of PTEN transfected lysate using anti-PTEN monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PTEN purified MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol