H00200576-B02P

PIKFYVE antibody from Abnova Corporation
FAB1, KIAA0981, MGC40423, p235, PIKfyve, PIP5K, PIP5K3, ZFYVE29

Antibody data

Product number
H00200576-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00200576-B02P, RRID:AB_11188567
Product name
PIP5K3 purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00200576-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PIP5K3 protein.
Antigen sequence
MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTP
DQDEPPFKSAYSSFVNLFRFNKERAEGGQGEQQPL
SGSWTSPQLPSRTQSVRSPTPYKKQLNEELQRRSS
ALGDLRACTYCRKIALSYAHSTDSNSIGEDLNALS
DSACSVSVLDPSEPRTPVGSRKASRNIFLEDDLAW
QSLIHPDSSNTPLSTRLVSVQEDAGKSPARNRSAS
ITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETT
EDERKILLDSVQLKDLWKKICHHSSGMEFQDHRYW
LRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQA
MVDGRWLDCVSHHDQLFRDEYALYRPLQSTEFSET
PSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAE
EGDDNLANSASPSKRTSVSSFQSTVDSDSAASISL
NVELDNVNFHIKKPSKYPHVPPHPADQKGRR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -