H00200576-M01
antibody from Abnova Corporation
Targeting: PIKFYVE
FAB1, KIAA0981, MGC40423, p235, PIP5K, PIP5K3, ZFYVE29
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00200576-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00200576-M01, RRID:AB_489912
- Product name
- PIP5K3 monoclonal antibody (M01), clone 6C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PIP5K3.
- Antigen sequence
LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFD
DSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVD
SDSAASISLNVELDNVNFHIKKPSKYPHVPPHPAD
QKGRR- Isotype
- IgG
- Antibody clone number
- 6C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Critical roles of type III phosphatidylinositol phosphate kinase in murine embryonic visceral endoderm and adult intestine.
PIKfyve regulates CaV1.2 degradation and prevents excitotoxic cell death.
Takasuga S, Horie Y, Sasaki J, Sun-Wada GH, Kawamura N, Iizuka R, Mizuno K, Eguchi S, Kofuji S, Kimura H, Yamazaki M, Horie C, Odanaga E, Sato Y, Chida S, Kontani K, Harada A, Katada T, Suzuki A, Wada Y, Ohnishi H, Sasaki T
Proceedings of the National Academy of Sciences of the United States of America 2013 Jan 29;110(5):1726-31
Proceedings of the National Academy of Sciences of the United States of America 2013 Jan 29;110(5):1726-31
PIKfyve regulates CaV1.2 degradation and prevents excitotoxic cell death.
Tsuruta F, Green EM, Rousset M, Dolmetsch RE
The Journal of cell biology 2009 Oct 19;187(2):279-94
The Journal of cell biology 2009 Oct 19;187(2):279-94
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PIP5K3 expression in transfected 293T cell line by PIP5K3 monoclonal antibody (M01), clone 6C7.Lane 1: PIP5K3 transfected lysate(50.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PIP5K3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PIP5K3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to PIP5K3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol