Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005159-M08 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005159-M08, RRID:AB_714691
- Product name
- PDGFRB monoclonal antibody (M08), clone 4C12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PDGFRB.
- Antigen sequence
LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQ
EPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTH
NDSRGLETDERKRLYIFVPDPTVGFLPNDAE- Isotype
- IgG
- Antibody clone number
- 4C12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PDGFRB monoclonal antibody (M08), clone 4C12. Western Blot analysis of PDGFRB expression in human stomach.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PDGFRB monoclonal antibody (M08), clone 4C12. Western Blot analysis of PDGFRB expression in human uterus myoma.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PDGFRB is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of PDGFRB transfected lysate using anti-PDGFRB monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PDGFRB MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between STAT1 and PDGFRB. Mahlavu cells were stained with anti-STAT1 rabbit purified polyclonal 1:1200 and anti-PDGFRB mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
