HPA051224

PYHIN1 antibody from Atlas Antibodies
IFIX, MGC23885
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA051224
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA051224, RRID:AB_2681394
Product name
Anti-PYHIN1
Provider product page
Atlas Antibodies - HPA051224
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTA
KGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPS
CS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -