H00000598-M01
antibody from Abnova Corporation
Targeting: BCL2L1
Bcl-X, bcl-xL, bcl-xS, BCL2L, BCLX, PPP1R52
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000598-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000598-M01, RRID:AB_425324
- Product name
- BCL2L1 monoclonal antibody (M01), clone 3E2-2A5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant BCL2L1.
- Antigen sequence
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRT
EAPEGTESEMETPSAINGNPSWHLADSPAVNGATG
HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAF
SDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI
VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLN
DHLEPWIQENGGWDTFVELYGNNAAAESRKGQERF
NRWFLTGMTVAGVVLLGSLFSRK- Isotype
- IgG
- Antibody clone number
- 3E2-2A5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A BACH2-BCL2L1 fusion gene resulting from a t(6;20)(q15;q11.2) chromosomal translocation in the lymphoma cell line BLUE-1.
Türkmen S, Riehn M, Klopocki E, Molkentin M, Reinhardt R, Burmeister T
Genes, chromosomes & cancer 2011 Jun;50(6):389-96
Genes, chromosomes & cancer 2011 Jun;50(6):389-96
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BCL2L1 monoclonal antibody (M01), clone 3E2-2A5 Western Blot analysis of BCL2L1 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of BCL2L1 expression in transfected 293T cell line by BCL2L1 monoclonal antibody (M01), clone 3E2-2A5.Lane 1: BCL2L1 transfected lysate (Predicted MW: 26 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged BCL2L1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to BCL2L1 on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between BID and BCL2L1. HeLa cells were stained with anti-BID rabbit purified polyclonal 1:1200 and anti-BCL2L1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)