H00000598-D01P

BCL2L1 antibody from Abnova Corporation
Bcl-X, bcl-xL, bcl-xS, BCL2L, BCLX, PPP1R52

Antibody data

Product number
H00000598-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000598-D01P, RRID:AB_1571671
Product name
BCL2L1 purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00000598-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human BCL2L1 protein.
Antigen sequence
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRT
EAPEGTESEMETPSAINGNPSWHLADSPAVNGATG
HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAF
SDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI
VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLN
DHLEPWIQENGGWDTFVELYGNNAAAESRKGQERF
NRWFLTGMTVAGVVLLGSLFSRK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -