H00000598-D01P
antibody from Abnova Corporation
Targeting: BCL2L1
Bcl-X, bcl-xL, bcl-xS, BCL2L, BCLX, PPP1R52
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000598-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000598-D01P, RRID:AB_1571671
- Product name
- BCL2L1 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human BCL2L1 protein.
- Antigen sequence
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRT
EAPEGTESEMETPSAINGNPSWHLADSPAVNGATG
HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAF
SDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI
VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLN
DHLEPWIQENGGWDTFVELYGNNAAAESRKGQERF
NRWFLTGMTVAGVVLLGSLFSRK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BCL2L1 expression in transfected 293T cell line (H00000598-T01) by BCL2L1 MaxPab polyclonal antibody.Lane 1: BCL2L1 transfected lysate(26.00 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BCL2L1 MaxPab rabbit polyclonal antibody. Western Blot analysis of BCL2L1 expression in human spleen.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BCL2L1 MaxPab rabbit polyclonal antibody. Western Blot analysis of BCL2L1 expression in A-431.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to BCL2L1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between BCL2L1 and BAX. HeLa cells were stained with anti-BCL2L1 rabbit purified polyclonal 1:1200 and anti-BAX mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)