Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004259-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004259-A01, RRID:AB_463740
- Product name
- MGST3 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant MGST3.
- Antigen sequence
NVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQ
NTLEVYPPFLFFLAVGGVYHPR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Sodium nitroprusside decreased leukotriene C4 generation by inhibiting leukotriene C4 synthase expression and activity in hepatic ischemia-reperfusion injured rats.
Increased leukotriene c4 synthesis accompanied enhanced leukotriene c4 synthase expression and activities of ischemia-reperfusion-injured liver in rats.
Yang SL, Lou YJ
Biochemical pharmacology 2007 Mar 1;73(5):724-35
Biochemical pharmacology 2007 Mar 1;73(5):724-35
Increased leukotriene c4 synthesis accompanied enhanced leukotriene c4 synthase expression and activities of ischemia-reperfusion-injured liver in rats.
Yang SL, Huang X, Chen HF, Xu D, Chen LJ, Kong Y, Lou YJ
The Journal of surgical research 2007 Jun 1;140(1):36-44
The Journal of surgical research 2007 Jun 1;140(1):36-44
No comments: Submit comment
No validations: Submit validation data