Explore
Validate
LearnPAB29562
antibody from Abnova Corporation
Targeting: ABCB1
ABC20, CD243, CLCS, GP170, MDR1, P-gp, PGY1
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29562 - Provider product page
- Provider
- Abnova Corporation
- Product name
- ABCB1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial synthetic protein of human ABCB1.
- Antigen sequence
IYFKLVTMQTAGNEVELENAADESKSEIDA- Isotype
- IgG
- Storage
- Store at -20°C.After reconstitution with 0.2 mL of deionized water, store at 4°C for 1 month. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining (Frozen sections) of mouse intestine tissue (A) and rat kidney tissue (B) with ABCB1 polyclonal antibody (Cat # PAB29562) under 0.5-1 ug/mL working concentration.
- Validation comment
- Immunohistochemistry (Frozen sections)
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung cancer tissue with ABCB1 polyclonal antibody (Cat # PAB29562) under 0.5-1 ug/mL working concentration.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
