HPA002199

ABCB1 antibody from Sigma-Aldrich
ABC20, CD243, CLCS, GP170, MDR1, P-gp, PGY1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002199
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002199, RRID:AB_1844428
Product name
Anti-ABCB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002199
Antibody type
Polyclonal
Antigen
Multidrug resistance protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IAHRLSTVRNADVIAGFDDGVIVEKGNHDELMKEK
GIYFKLVTMQTAGNEVELENAADESKSEIDALEMS
SNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALD
E
Storage
-20C
Provider Type Product Number
- No reagents -