HPA028345

NPL antibody from MilliporeSigma / Merck KGaA
C1orf13, DHDPS1, NPL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028345
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028345, RRID:AB_10610145
Product name
Anti-NPL antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028345
Antibody type
Polyclonal
Antigen
N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVD
QNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNY
L
Storage
-20C
Provider Type Product Number
- No reagents -