HPA026114

HTT antibody from Sigma-Aldrich
HD, IT15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026114
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026114, RRID:AB_1851330
Product name
Anti-HTT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026114
Antibody type
Polyclonal
Antigen
Huntingtin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGD
QENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFL
LTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPE
SFFSKLYKVPLD
Storage
-20C
Provider Type Product Number
- No reagents -