Antibody data

Product number
ABIN406405
Provider
antibodies-online
Product name
anti-Fibromodulin (FMOD) (N-Term) antibody
Provider product page
antibodies-online - ABIN406405
Antibody type
Polyclonal
Antigen
The immunogen for anti-FMOD antibody: synthetic peptide directed towards the N terminal of human FMOD
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine
Host
Rabbit
Antigen sequence
VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSD
KVGRK VFSKLRHLER
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -