H00005287-M02A

PIK3C2B antibody from Abnova Corporation
C2-PI3K, PI3K-C2beta

Antibody data

Product number
H00005287-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005287-M02A, RRID:AB_1578752
Product name
PIK3C2B monoclonal antibody (M02A), clone 3E5
Provider product page
Abnova Corporation - H00005287-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PIK3C2B.
Antigen sequence
MSSTQDNGEHWKSLESVGISRKELAMAEALQMEYD
ALSRLRHDKEENRAKQNADPSLISWDEPGVDFYSK
PAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNH
STSQG
Isotype
IgG
Antibody clone number
3E5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -