HPA029124

LRRN2 antibody from MilliporeSigma / Merck KGaA
FIGLER7, GAC1, LRANK1, LRRN5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029124
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029124, RRID:AB_10601545
Product name
Anti-LRRN2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029124
Antibody type
Polyclonal
Antigen
leucine rich repeat neuronal 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GADTKTVSVVVGRALLQPGRDEGQGLELRVQETHP
YHILLSWVTPPNTVSTNLTWSSASSLRGQGATALA
RLPRGTHSYNITRLLQATEYWACLQVAFADAHTQL
ACVWARTK
Storage
-20C
Provider Type Product Number
- No reagents -