Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311055 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Thymidylate Synthetase (TYMS) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TYMS antibody: synthetic peptide directed towards the C terminal of human TYMS
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAED
FQIEG YNPHPTIKME- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
Ikeda S, Sasazuki S, Natsukawa S, Shaura K, Koizumi Y, Kasuga Y, Ohnami S, Sakamoto H, Yoshida T, Iwasaki M, Tsugane S
The American journal of gastroenterology 2008 Jun;103(6):1476-87
The American journal of gastroenterology 2008 Jun;103(6):1476-87
No comments: Submit comment
No validations: Submit validation data