HPA028039

COG2 antibody from MilliporeSigma / Merck KGaA
LDLC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028039
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028039, RRID:AB_10611820
Product name
Anti-COG2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028039
Antibody type
Polyclonal
Antigen
component of oligomeric golgi complex 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPTTASSYVDSALKPLFQLQSGHKDKLKQAIIQQW
LEGTLSESTHKYYETVSDVLNSVKKMEESLKRLKQ
ARKTTPANPVGPSGGMSDDD
Storage
-20C
Provider Type Product Number
- No reagents -