AMAb91038

antibody from Atlas Antibodies

Targeting: S100B S100beta

Western blot (Supportive data in Antibodypedia)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

AMAb91038

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#AMAb91038, RRID:AB_2665776

Product name

Anti-S100B

Antibody type

Monoclonal

Reactivity

Human, Mouse, Rat

Host

Mouse

Conjugate

Unconjugated

Antigen sequence

LEKAMVALIDVFHQYSGREGDKHKLKKSELKELIN
NELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQE
FMAFVAMVTTACHEFFEHE


Isotype

IgG

Antibody clone number

CL2720

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Western blot

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human cerebral cortex and kidney tissues using AMAb91038 antibody. Corresponding S100B RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat cerebellum shows strong immunoreactivity in glial cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of mouse cerebellum shows moderate positivity in glial cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows moderate immunoreactivity in a subset of astrocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of rat hippocampus shows strong immunoreactivity in a subset of astrocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebellum shows strong immunoreactivity in glial cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human kidney shows absence of immunoreactivity (negative control).

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of rat brain shows strong positivity in glial cells in the cerebellum.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of rat brain shows moderate positivity in astrocytes in the hippocampus.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse brain shows moderate positivity in the cerebellum.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in astrocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebellum shows strong nuclear positivity in glial cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human kidney shows no nuclear positivity as expected.