PA5-95479
antibody from Invitrogen Antibodies
Targeting: C4A
C4, C4A2, C4A3, C4A4, C4A6, C4B, C4S, CO4, CPAMD2, RG
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PA5-95479 - Provider product page
- Provider
- Invitrogen Antibodies
- Product name
- Anti-Complement C4 Polyclonal Antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide
- Description
- Synthetic peptide sequence: YMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQ. Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Isotype
- IgG
- Vial size
- 100 µg
- Concentration
- Lot Dependent
- Storage
- Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- Invitrogen Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of Complement C4 in Lane 1: human SMMC-7721 cell lysates. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with Complement C4 polyclonal antibody (Product # PA5-95479) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL).