Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91307 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91307, RRID:AB_2665892
- Product name
- Anti-SOX2
- Antibody type
- Monoclonal
- Reactivity
- Human, Mouse
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVS
ALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALG
SM- Epitope
- Binds to an epitope located within the peptide sequence GYPQHPGLNA as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL4716
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SOX2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line NTERA-2.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of U-251 cells using the anti-SOX2 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse embryo E11 shows nuclear immunoreactivity in the developing brain, eye and trigeminal ganglion.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse embryo E11 shows nuclear immunoreactivity in the developing neural tube.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix shows nuclear immunoreactivity in basal layer cells of squamous epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows no positivity as expected (negative control).