Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404762 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SRY (Sex Determining Region Y)-Box 2 (SOX2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SOX2 antibody: synthetic peptide directed towards the N terminal of human SOX2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQK
NSPDR VKRPMNAFMV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression of pluripotency factors in larval epithelia of the frog Xenopus: evidence for the presence of cornea epithelial stem cells.
Novel SOX2 mutation associated with ocular coloboma in a Chinese family.
Perry KJ, Thomas AG, Henry JJ
Developmental biology 2013 Feb 15;374(2):281-94
Developmental biology 2013 Feb 15;374(2):281-94
Novel SOX2 mutation associated with ocular coloboma in a Chinese family.
Wang P, Liang X, Yi J, Zhang Q
Archives of ophthalmology 2008 May;126(5):709-13
Archives of ophthalmology 2008 May;126(5):709-13
No comments: Submit comment
No validations: Submit validation data