HPA004863

TNFSF12 antibody from Sigma-Aldrich
APO3L, DR3LG, TWEAK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004863
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004863, RRID:AB_1078187
Product name
Anti-TNFSF12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004863
Antibody type
Polyclonal
Antigen
Tumor necrosis factor ligand superfamily member 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEAWENGERSRKRRAVLTQKQKKQHSVLHLVPINA
TSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDA
GVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFR
CIRSMPSHPDRAYNSCYSAGVFHLHQGDILS
Storage
-20C
Provider Type Product Number
- No reagents -