H00000916-M01

CD3E antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00000916-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000916-M01, RRID:AB_1204096
Product name
CD3E monoclonal antibody (M01), clone 3H5
Provider product page
Abnova Corporation - H00000916-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CD3E.
Antigen sequence
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEI
LWQRNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQ
SGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDV
MSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPV
TRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRD
LYSGLNQRRI
Isotype
IgG
Antibody clone number
3H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -