Antibody data

Product number
H00000916-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000916-M03, RRID:AB_1204095
Product name
CD3E monoclonal antibody (M03), clone 3E12
Provider product page
Abnova Corporation - H00000916-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CD3E.
Antigen sequence
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEI
LWQRNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQ
SGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDV
MSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPV
TRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRD
LYSGLNQRRI
Isotype
IgG
Antibody clone number
3E12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -