HPA037756

antibody from Atlas Antibodies

Targeting: CD8A CD8

Antibody data

Submit

Validation data

Product number: HPA037756 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA037756, RRID:AB_2675648
Product name: Anti-CD8A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTF VLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFL PAKPTTTPAPRPPT
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CD8A protein structure - HPA037756 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human spleen and skeletal muscle tissues using HPA037756 antibody. Corresponding CD8A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows moderate to strong positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows moderate to strong positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate to strong positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity as expected.
Sample type: HUMAN