HPA005715

GTF2A1L antibody from Sigma-Aldrich
ALF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005715
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005715, RRID:AB_1080113
Product name
Anti-STON1-GTF2A1L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005715
Antibody type
Polyclonal
Antigen
Stonin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSPLAISGGESSLLPTRPTCLSHALLPSDHSCTHP
TPKVGLPDEVNPQQAESLGFQSDDLPQFQYFREDC
AFSSPFWKDEGSDSHFTLDPPGSKKMFSSRNKEMP
IDQKSLNKCSLNYICEKLEHLQSAENQDSLR
Storage
-20C
Provider Type Product Number
- No reagents -