Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001817 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001817, RRID:AB_1078779
- Product name
- Anti-CFB
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGM
VWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAV
VSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEI
EVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNK
LKYG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.
Cancer genetics-guided discovery of serum biomarker signatures for diagnosis and prognosis of prostate cancer.
Ca2+/calmodulin-dependent kinase II triggers cell membrane injury by inducing complement factor B gene expression in the mouse heart
Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlén M, Nilsson P, Spector TD, Schwenk JM
Proteome science 2011 Nov 17;9:73
Proteome science 2011 Nov 17;9:73
Cancer genetics-guided discovery of serum biomarker signatures for diagnosis and prognosis of prostate cancer.
Cima I, Schiess R, Wild P, Kaelin M, Schüffler P, Lange V, Picotti P, Ossola R, Templeton A, Schubert O, Fuchs T, Leippold T, Wyler S, Zehetner J, Jochum W, Buhmann J, Cerny T, Moch H, Gillessen S, Aebersold R, Krek W
Proceedings of the National Academy of Sciences of the United States of America 2011 Feb 22;108(8):3342-7
Proceedings of the National Academy of Sciences of the United States of America 2011 Feb 22;108(8):3342-7
Ca2+/calmodulin-dependent kinase II triggers cell membrane injury by inducing complement factor B gene expression in the mouse heart
Singh M, Kapoun A, Higgins L, Kutschke W, Thurman J, Zhang R, Singh M, Yang J, Guan X, Lowe J, Weiss R, Zimmermann K, Yull F, Blackwell T, Mohler P, Anderson M
Journal of Clinical Investigation
Journal of Clinical Investigation
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate positivity of secretion surrounding Leydig cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate positivity in secretion surrounding cells in tubules.
- Sample type
- HUMAN