HPA001832

CFB antibody from Sigma-Aldrich
BF, BFD, H2-Bf
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001832
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001832, RRID:AB_1078778
Product name
Anti-AL662849.8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001832
Antibody type
Polyclonal
Antigen
Complement factor B precursor containing complement factor B Ba fragment and complement factor B Bb fragment, recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSS
LTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIY
LVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKP
RYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEI
NYEDHKL
Storage
-20C
Provider Type Product Number
- No reagents -