Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1861018 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Glucagon (GCG) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic Peptide, GLP2 conjugated to OVA
- Description
- Affinity Chromatography
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
The target peptide sequence is HADG
SFSDEMNTILDNLAARDFINWLIQTKITDR- Isotype
- IgG
- Vial size
- 100 μg
- Concentration
- 200 μg/mL
- Storage
- Store at 4°C for frequent use. Stored at -20°C to -80°C in a manual defrost freezer for one year without detectable loss of activity.
- Handling
- Avoid repeated freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data