Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003692-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003692-A01, RRID:AB_463347
- Product name
- ITGB4BP polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant ITGB4BP.
- Antigen sequence
VLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP
LVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTEL
SVVESVFKLNEAQPSTIATSMRDSLIDSLT- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Process of Hypertrophic Scar Formation: Expression of Eukaryotic Initiation Factor 6.
Identification of ITGB4BP as a new interaction protein of P311.
Yang QQ, Yang SS, Tan JL, Luo GX, He WF, Wu J
Chinese medical journal 2015 Oct 20;128(20):2787-91
Chinese medical journal 2015 Oct 20;128(20):2787-91
Identification of ITGB4BP as a new interaction protein of P311.
Peng X, Yuan S, Tan J, Ma B, Bian X, Xu C, He W, Cao H, Huang Z, Cui Y, Gan C, Wang X, Zhou J, Hu J, Yang S, Luo G, Wu J
Life sciences 2012 Apr 20;90(15-16):585-90
Life sciences 2012 Apr 20;90(15-16):585-90
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ITGB4BP polyclonal antibody (A01), Lot # 051122JC01 Western Blot analysis of ITGB4BP expression in HL-60 ( Cat # L014V1 ).